PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000125.1_g00064.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 306aa    MW: 33208.9 Da    PI: 7.0647
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000125.1_g00064.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.43.5e-3355110359
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              ++rY+eClkNhA+ +GghavDGCgEfmp+ ge+gt ++lkCaACgCHRnFHR+e+e 
  Itr_sc000125.1_g00064.1  55 RYRYRECLKNHAVGIGGHAVDGCGEFMPA-GEDGTLDSLKCAACGCHRNFHRKEEEG 110
                              689*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047705.6E-3056108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.7E-3157107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2257109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.01658107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.61E-18162234IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-30164234IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-23175231IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MDFDEEQEEE IEMHEMEPEG NYPPLGSSGM GGGEETAGER KNGGGGGGDG GGGIRYRYRE  60
CLKNHAVGIG GHAVDGCGEF MPAGEDGTLD SLKCAACGCH RNFHRKEEEG DGFSHFHHHH  120
HPHLTAYPSF RPSGYLHVAP HRPLALPSSS RDDDVSNPSS SGGAGAAADG GAGSKKRFRT  180
KFSQEQKDKM LAFAERLEWR IQKHDEEAVQ EFCATTNVRR QVFKVWMHNN KHTLGGLRYC  240
VNVKGRMSEK ERSRDGAVGK MITRGGSGPG GPTGLVVLYS VPVDKHACGA TKFPLPFIPH  300
LSFSTH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-261742331675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266504.15e-82PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ9SB616e-71ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A068USE61e-78A0A068USE6_COFCA; Uncharacterized protein
TrEMBLA5BZD72e-78A5BZD7_VITVI; Putative uncharacterized protein
TrEMBLF6H1066e-79F6H106_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g07140.t012e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-66homeobox protein 22